PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000231845
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 528aa    MW: 60657.2 Da    PI: 7.1647
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000231845genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM134.66.5e-42191423126
            NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                    +GfrFhPt eelv++yLk k ++k++++ e i+evd+++++P dL +++ +++ ewyfF +++ ky+++kr+nr+t  gyWk tgk+++++ + ++
  MDP0000231845  19 VGFRFHPTGEELVDHYLKLKKQDKDFQA-ENIPEVDVCNFDPGDLAARMPSDDMEWYFFGRKNYKYKNSKRSNRTTPGGYWKITGKERDIKXRrSK 113
                    7***************************.78**************99999999**************************************98566 PP

            NAM  98 elvglkktLvfykgrapkgektdWvmhey 126
                    +++g k+tL+fy+  +pk++kt+Wvmhe 
  MDP0000231845 114 AVIGKKRTLTFYRRCEPKPKKTNWVMHEH 142
                    779************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100545.07317165IPR003441NAC domain
PfamPF023655.6E-2219142IPR003441NAC domain
SuperFamilySSF1019412.75E-4719165IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
METPGRKRKT RGGGGSGQVG FRFHPTGEEL VDHYLKLKKQ DKDFQAENIP EVDVCNFDPG  60
DLAARMPSDD MEWYFFGRKN YKYKNSKRSN RTTPGGYWKI TGKERDIKXR RSKAVIGKKR  120
TLTFYRRCEP KPKKTNWVMH EHDRIDSEAN PKLPQDFVIC RMKKKSDEED TSIGEVELGS  180
CSVSNVEDHA AAVVTPGVRM RIVWSFNIYL MDHEKFIETY ASLFDSLQSQ DNSSSTPLSS  240
GYIELEDVLQ ANGTNDDCNA IQSPFGDNNY SYINKNDIST CDEGEPHSFT VSDLKNEAPH  300
NMSQQSQNDM DSLCLHVAQE SPTCVISKNN VSTSDDDEQF KNSISNFENQ ATNKRISEVC  360
PPPEEDMEFX FDLPFFFDLP QLEDYTLRKE IERIHGCKRL QFGKQNVPXN MAVLQFGKQN  420
VPHEHDSAIT TLRSDEEIDI ELSELFEVEK RSKTQSWRPV VGIWESRADL MSSLKRRYRR  480
RTKRSNGRLA KPPPPAGXFL SKFMCLKQVH LHRKFPSAMS LNPLILKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-282016520165NAC domain-containing protein 19
4dul_A2e-282016520165NAC domain-containing protein 19
1ut7_B2e-282016520165NO APICAL MERISTEM PROTEIN
1ut7_A2e-282016520165NO APICAL MERISTEM PROTEIN
1ut4_B2e-282016520165NO APICAL MERISTEM PROTEIN
1ut4_A2e-282016520165NO APICAL MERISTEM PROTEIN
3swp_D2e-282016523168NAC domain-containing protein 19
3swp_C2e-282016523168NAC domain-containing protein 19
3swp_B2e-282016523168NAC domain-containing protein 19
3swp_A2e-282016523168NAC domain-containing protein 19
3swm_D2e-282016523168NAC domain-containing protein 19
3swm_C2e-282016523168NAC domain-containing protein 19
3swm_B2e-282016523168NAC domain-containing protein 19
3swm_A2e-282016523168NAC domain-containing protein 19
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1475483RRYRRRTKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.57012e-97fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376247.10.0PREDICTED: NAC domain-containing protein 72-like
RefseqXP_008376246.10.0PREDICTED: NAC domain-containing protein 72-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14450518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.18e-31NAC 014